PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORGLA01G0053500.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MYB_related
Protein Properties Length: 366aa    MW: 39087 Da    PI: 9.2723
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORGLA01G0053500.1genomeAGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding41.14.2e-13109153347
                        SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
    Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                        +WT+eE+  ++ + ++lG+g+W+ I+r +   Rt+ q+ s+ qky
  ORGLA01G0053500.1 109 PWTEEEHRMFLMGLQKLGKGDWRGISRNFVVSRTPTQVASHAQKY 153
                        8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.60.100.001223IPR001878Zinc finger, CCHC-type
PROSITE profilePS501588.565319IPR001878Zinc finger, CCHC-type
PROSITE profilePS5129419.1102158IPR017930Myb domain
SuperFamilySSF466891.12E-16104158IPR009057Homeodomain-like
TIGRFAMsTIGR015579.0E-19105157IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.603.8E-12106152IPR009057Homeodomain-like
SMARTSM007172.6E-11106156IPR001005SANT/Myb domain
PfamPF002491.1E-10109153IPR001005SANT/Myb domain
CDDcd001674.83E-9109154No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 366 aa     Download sequence    Send to blast
MTRRCSHCSN NGHNARTCPA RGGGGGGGGV RLFGVRLTSP PEVAMKKSAS MSCIASSLGS  60
GGGSGGSSPA GTGRGGGGGG EGAAGYASDD PTHASCSTNG RGERKKGTPW TEEEHRMFLM  120
GLQKLGKGDW RGISRNFVVS RTPTQVASHA QKYFIRQTNS SRRKRRSSLF DMVPEMPMDE  180
SPVVVEQLML HSTQDEATSS NQLPISHLVK QKEPEFARHL SDLQLRKHEE SEFTEPSLAA  240
LDLEMNHAAP FKTKFVLTMP TFYPALIPVP LTLWPPNVAN VGDSGTNHEI LKPTPVNGKE  300
VINKADEVVG MSKLTIDDGS SNSIEPSALS LQLTGPTNTR QSAFHVNPPM AGPDLNKRNN  360
SPIHAV
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0716110.0AK071611.1 Oryza sativa Japonica Group cDNA clone:J023105I20, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015621787.10.0PREDICTED: transcription factor MYB1R1
TrEMBLA0A0D3EKH70.0A0A0D3EKH7_9ORYZ; Uncharacterized protein
TrEMBLI1NKZ50.0I1NKZ5_ORYGL; Uncharacterized protein
STRINGORGLA01G0053500.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP19393791
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G47390.15e-75MYB_related family protein